PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G2509
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 585aa    MW: 63440.6 Da    PI: 6.811
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G2509genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.8e-10418475562
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l+++
  Gh_D13G2509 418 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQ 475
                  9********************************************9998877666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-18414478IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737416479IPR004827Basic-leucine zipper domain
PfamPF001707.0E-9418472IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.7E-11418474No hitNo description
SuperFamilySSF579592.46E-11418469No hitNo description
CDDcd147032.19E-24419468No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MGDGEEGNTD VMQRIQSSFG TSSSSIPKQP LSMNHLEIPQ LNPNQIRGAA RHFSHFGQNF  60
NGGAAAGTGD GATNKRVGIP PSHPNQIPPI SPYSQIPMSR PSNQQMGSQS FNSGPTHSRS  120
LSQPSSFFSL DSLPPLSPSP FRDSSSMAVS DQVSTDVSMD ERDAAASHSL LPPSPFSKAN  180
SPRLGESLPP RKSHRRSSSD IPFGFNTIMQ FSPPLIPLRG SSKPAQLVKK ETSDGNGEGM  240
GERKSEGEVV DDLFSAYMNL DNMDALNPCD GKNNNGNENH EDLDSRASGT KTNGVDSSDN  300
EAESSVNESG NSSRGGMNST EKREGNKRAA GADIAPSGRH YRSVSMDSFI GNLNFGDESP  360
KLPPSPGNRL GQLSPRNSID GNSAAFSLEF GNGEFTEAEL KKIMANEKLA EIAMTDPKRA  420
KRILANRQSA ARSKERKMRY ISELEHKVQT LQTEATTLSA QLTLLQRDSV GLTNQNNELK  480
FRLQAMEQQA QLRDALNEAL TAEVQRLKRA TQQLGGDSDP SKGMVSEPLS VNQQMFQLNI  540
SHQMQKQSPP QPQQQNGXSH QMQQQSPPQP QQQNGNTTAK TELNQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.30330.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441810.10.0PREDICTED: uncharacterized protein LOC105766783
RefseqXP_012441813.10.0PREDICTED: uncharacterized protein LOC105766783
TrEMBLA0A0B0NLJ50.0A0A0B0NLJ5_G
STRINGPOPTR_0009s12830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-142bZIP family protein